Recombinant Full Length Human PLEKHD1 Protein, GST-tagged

Cat.No. : PLEKHD1-4934HF
Product Overview : Human FLJ44817 full-length ORF (1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 114 amino acids
Description : PLEKHD1 (Pleckstrin Homology And Coiled-Coil Domain Containing D1) is a Protein Coding gene. Diseases associated with PLEKHD1 include Atrial Heart Septal Defect.
Molecular Mass : 39.3 kDa
AA Sequence : MFTSKSNSVSPSPSLEQADSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLLYYSESEKKSFETNKYFNIHPKVRRPLPGPQQGRAQCGHQSLHLVRGGDCALALA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLEKHD1 pleckstrin homology and coiled-coil domain containing D1 [ Homo sapiens (human) ]
Official Symbol PLEKHD1
Synonyms PLEKHD1; pleckstrin homology and coiled-coil domain containing D1; UPF0639; pleckstrin homology domain-containing family D member 1; PH domain-containing family D member 1; UPF0639 protein; pleckstrin homology domain containing, family D (with M protein repeats) member 1; pleckstrin homology domain containing, family D (with coiled-coil domains) member 1; Pleckstrin Homology And Coiled-Coil Domain Containing D1; Pleckstrin Homology Domain Containing, Family D (With Coiled-Coil Domains) Member 1; Pleckstrin Homology Domain Containing, Family D (With M Protein Repeats) Member 1; PH Domain-Containing Family D Member 1; Pleckstrin Homology Domain-Containing Family D Member 1; UPF0639 Protein
Gene ID 400224
mRNA Refseq NM_001161498
Protein Refseq NP_001154970
UniProt ID A6NEE1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEKHD1 Products

Required fields are marked with *

My Review for All PLEKHD1 Products

Required fields are marked with *

0
cart-icon