Recombinant Full Length Human PLIN1 Protein, C-Flag-tagged
Cat.No. : | PLIN1-130HFL |
Product Overview : | Recombinant Full Length Human PLIN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.8 kDa |
AA Sequence : | MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAA WSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSD KVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPADKEESAPAPGHQQAQE SPKAKPSLLSRVGALTNTLSRYTVQTMARALEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVR VPWLHSLAAAQEEDHEDQTDTEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAV TWAPAAVLGMAGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAPRPGFPAVPRE KPKRRVSDSFFRPSVMEPILGRTHYSQLRKKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | PLIN1 perilipin 1 [ Homo sapiens (human) ] |
Official Symbol | PLIN1 |
Synonyms | PERI; PLIN; FPLD4 |
Gene ID | 5346 |
mRNA Refseq | NM_002666.5 |
Protein Refseq | NP_002657.3 |
MIM | 170290 |
UniProt ID | O60240 |
◆ Recombinant Proteins | ||
PLIN1-3842C | Recombinant Chicken PLIN1 | +Inquiry |
PLIN1-4184R | Recombinant Rat PLIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLIN1-12971M | Recombinant Mouse PLIN1 Protein | +Inquiry |
Plin1-8044M | Recombinant Mouse Plin1 protein, His & GST-tagged | +Inquiry |
PLIN1-531H | Recombinant Human PLIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PLIN1-001H | Recombinant Human PLIN1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLIN1 Products
Required fields are marked with *
My Review for All PLIN1 Products
Required fields are marked with *
0
Inquiry Basket