Recombinant Full Length Human PLTP Protein, C-Flag-tagged
Cat.No. : | PLTP-318HFL |
Product Overview : | Recombinant Full Length Human PLTP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53 kDa |
AA Sequence : | MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMK VSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVD ELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESY FRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASV TIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADVRASTAPTPST AAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | PLTP phospholipid transfer protein [ Homo sapiens (human) ] |
Official Symbol | PLTP |
Synonyms | BPIFE; HDLCQ9 |
Gene ID | 5360 |
mRNA Refseq | NM_006227.4 |
Protein Refseq | NP_006218.1 |
MIM | 172425 |
UniProt ID | P55058 |
◆ Recombinant Proteins | ||
PLTP-2600H | Recombinant Human PLTP Protein, His-tagged | +Inquiry |
Pltp-6861M | Recombinant Mouse Pltp Protein, His (Fc)-Avi-tagged | +Inquiry |
PLTP-6862M | Recombinant Mouse PLTP Protein, His (Fc)-Avi-tagged | +Inquiry |
PLTP-1736H | Recombinant Human PLTP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLTP-3970C | Recombinant Chicken PLTP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLTP-2065HCL | Recombinant Human PLTP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLTP Products
Required fields are marked with *
My Review for All PLTP Products
Required fields are marked with *
0
Inquiry Basket