Recombinant Full Length Human PMEL Protein, GST-tagged

Cat.No. : PMEL-6849HF
Product Overview : Human SILV full-length ORF ( NP_008859.1, 1 a.a. - 661 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 661 amino acids
Description : This gene encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.
Molecular Mass : 96.7 kDa
AA Sequence : MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PMEL premelanosome protein [ Homo sapiens (human) ]
Official Symbol PMEL
Synonyms PMEL; premelanosome protein; P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E; melanocyte protein PMEL; melanocyte protein Pmel 17; melanocyte protein mel 17; melanocytes lineage-specific antigen GP100; melanoma-associated ME20 antigen; melanosomal matrix protein17; silver locus protein homolog; silver, mouse, homolog of
Gene ID 6490
mRNA Refseq NM_006928
Protein Refseq NP_008859
MIM 155550
UniProt ID P40967

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMEL Products

Required fields are marked with *

My Review for All PMEL Products

Required fields are marked with *

0
cart-icon