Recombinant Full Length Human PMPCB Protein, C-Flag-tagged
Cat.No. : | PMPCB-899HFL |
Product Overview : | Recombinant Full Length Human PMPCB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the peptidase M16 family and encodes a protein with a zinc-binding motif. This protein is located in the mitochondrial matrix and catalyzes the cleavage of the leader peptides of precursor proteins newly imported into the mitochondria, though it only functions as part of a heterodimeric complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVA SEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTV YYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRT ILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFT GSEIRVRDDKMPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSF QSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICE DIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | PMPCB peptidase, mitochondrial processing subunit beta [ Homo sapiens (human) ] |
Official Symbol | PMPCB |
Synonyms | MAS1; MPPB; P-52; MPP11; MPPP52; Beta-MPP |
Gene ID | 9512 |
mRNA Refseq | NM_004279.3 |
Protein Refseq | NP_004270.2 |
MIM | 603131 |
UniProt ID | O75439 |
◆ Recombinant Proteins | ||
PMPCB-2055Z | Recombinant Zebrafish PMPCB | +Inquiry |
PMPCB-4203R | Recombinant Rat PMPCB Protein, His (Fc)-Avi-tagged | +Inquiry |
PMPCB-281H | Recombinant Human PMPCB, GST-tagged | +Inquiry |
PMPCB-4543R | Recombinant Rat PMPCB Protein | +Inquiry |
PMPCB-796C | Recombinant Cynomolgus PMPCB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMPCB Products
Required fields are marked with *
My Review for All PMPCB Products
Required fields are marked with *
0
Inquiry Basket