Recombinant Full Length Human PNKD Protein, C-Flag-tagged

Species :	Human
Source :	Mammalian Cells
Tag :	Flag
Description :	This gene is thought to play a role in the regulation of myofibrillogenesis. Mutations in this gene have been associated with the movement disorder paroxysmal non-kinesigenic dyskinesia. Alternative splicing results in multiple transcript variants.
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	38.9 kDa
AA Sequence :	MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKN PMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQA QLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCH QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLG LGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Transmembrane
Full Length :	Full L.

Gene Name	PNKD PNKD metallo-beta-lactamase domain containing [ Homo sapiens (human) ]
Official Symbol	PNKD
Synonyms	R1; MR1; PDC; DYT8; FPD1; MR-1; BRP17; MR-1S; PKND1; PNKD1; FKSG19; TAHCCP2; KIPP1184
Gene ID	25953
mRNA Refseq	NM_015488.5
Protein Refseq	NP_056303.3
MIM	609023
UniProt ID	Q8N490