Recombinant Full Length Human PNKD Protein, C-Flag-tagged
Cat.No. : | PNKD-642HFL |
Product Overview : | Recombinant Full Length Human PNKD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is thought to play a role in the regulation of myofibrillogenesis. Mutations in this gene have been associated with the movement disorder paroxysmal non-kinesigenic dyskinesia. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKN PMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQA QLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCH QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLG LGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PNKD PNKD metallo-beta-lactamase domain containing [ Homo sapiens (human) ] |
Official Symbol | PNKD |
Synonyms | R1; MR1; PDC; DYT8; FPD1; MR-1; BRP17; MR-1S; PKND1; PNKD1; FKSG19; TAHCCP2; KIPP1184 |
Gene ID | 25953 |
mRNA Refseq | NM_015488.5 |
Protein Refseq | NP_056303.3 |
MIM | 609023 |
UniProt ID | Q8N490 |
◆ Recombinant Proteins | ||
PNKD-1721H | Recombinant Human PNKD Protein, His (Fc)-Avi-tagged | +Inquiry |
PNKD-6878M | Recombinant Mouse PNKD Protein, His (Fc)-Avi-tagged | +Inquiry |
PNKD-13024M | Recombinant Mouse PNKD Protein | +Inquiry |
PNKD-642HFL | Recombinant Full Length Human PNKD Protein, C-Flag-tagged | +Inquiry |
PNKD-1974H | Recombinant Human PNKD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNKD-3083HCL | Recombinant Human PNKD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNKD Products
Required fields are marked with *
My Review for All PNKD Products
Required fields are marked with *
0
Inquiry Basket