Recombinant Full Length Human PNLIP Protein
| Cat.No. : | PNLIP-375HF |
| Product Overview : | Recombinant full length Human Pancreatic Lipase with N terminal proprietary tag; Predicted MWt 77.22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 465 amino acids |
| Description : | This gene is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas. |
| Form : | Liquid |
| Molecular Mass : | 77.220kDa inclusive of tags |
| AA Sequence : | MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERP LHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSN FKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSP SNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQ GTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGG CPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHS NEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVET NVGKQFNFCSPETVREEVLLTLTPC |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PNLIP pancreatic lipase [ Homo sapiens ] |
| Official Symbol | PNLIP |
| Synonyms | PNLIP; pancreatic lipase; pancreatic triacylglycerol lipase |
| Gene ID | 5406 |
| mRNA Refseq | NM_000936 |
| Protein Refseq | NP_000927 |
| MIM | 246600 |
| UniProt ID | P16233 |
| ◆ Recombinant Proteins | ||
| PNLIP-28H | Recombinant Human PNLIP Protein, N-His Tagged | +Inquiry |
| PNLIP-8599H | Recombinant Human PNLIP, His-tagged | +Inquiry |
| Pnlip-26R | Recombinant Rat Pnlip protein, His-tagged | +Inquiry |
| PNLIP-2603H | Recombinant Human PNLIP Protein, His-tagged | +Inquiry |
| Pnlip-4964M | Recombinant Mouse Pnlip Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
| PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
| PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PNLIP-1246HCL | Recombinant Human PNLIP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNLIP Products
Required fields are marked with *
My Review for All PNLIP Products
Required fields are marked with *
