Recombinant Full Length Human PNPLA2 Protein, C-Flag-tagged
Cat.No. : | PNPLA2-251HFL |
Product Overview : | Recombinant Full Length Human PNPLA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGVCLGEAGAKFI EVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDELIQ ANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNT SIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVE SAQAEDYSQLPGEDHILEHLPARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTI RLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQLAGPAPLLST PAPEARPVIGALGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PNPLA2 patatin like phospholipase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | PNPLA2 |
Synonyms | ATGL; TTS2; PEDF-R; FP17548; TTS-2.2; iPLA2zeta; 1110001C14Rik |
Gene ID | 57104 |
mRNA Refseq | NM_020376.4 |
Protein Refseq | NP_065109.1 |
MIM | 609059 |
UniProt ID | Q96AD5 |
◆ Recombinant Proteins | ||
PNPLA2-322H | Recombinant Human PNPLA2, His-tagged | +Inquiry |
PNPLA2-1333H | Recombinant Human PNPLA2 Protein, His-SUMO-tagged | +Inquiry |
PNPLA2-6888M | Recombinant Mouse PNPLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pnpla2-4972M | Recombinant Mouse Pnpla2 Protein, Myc/DDK-tagged | +Inquiry |
PNPLA2-381HF | Recombinant Full Length Human PNPLA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPLA2-3069HCL | Recombinant Human PNPLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA2 Products
Required fields are marked with *
My Review for All PNPLA2 Products
Required fields are marked with *
0
Inquiry Basket