Recombinant Full Length Human PODN Protein, C-Flag-tagged
Cat.No. : | PODN-780HFL |
Product Overview : | Recombinant Full Length Human PODN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the small leucine-rich repeat protein family and contains an amino terminal CX3CXCX7C cysteine-rich cluster followed by a leucine-rich repeat domain. Studies suggest that this protein could function to inhibit smooth muscle cell proliferation and migration following arterial injury. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74 kDa |
AA Sequence : | MEGARARGAQLRLGERVRPVGRRSAPGRSRFHQPWRPGASDSAPPAGTMAQSRVLLLLLLLPPQLHLGPV LAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACSQEGVVDCGGIDLREFPG DLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAP RFLPNALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHV PKHLPPALYKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSR VPAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALE RVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRL HTLPPGLPRNVHVLKVKRNELAALARGALAGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQ LTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGN LEFGDISKDRGRLGKEKEEEEEEEEEEEETRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PODN podocan [ Homo sapiens (human) ] |
Official Symbol | PODN |
Synonyms | PCAN; SLRR5A |
Gene ID | 127435 |
mRNA Refseq | NM_153703.5 |
Protein Refseq | NP_714914.3 |
MIM | 608661 |
UniProt ID | Q7Z5L7 |
◆ Recombinant Proteins | ||
Podn-4976M | Recombinant Mouse Podn Protein, Myc/DDK-tagged | +Inquiry |
PODN-6899M | Recombinant Mouse PODN Protein, His (Fc)-Avi-tagged | +Inquiry |
PODN-2604H | Recombinant Human PODN Protein, His-tagged | +Inquiry |
PODN-4012H | Recombinant Human PODN Protein (Gly20-Pro308), N-His tagged | +Inquiry |
PODN-1822H | Recombinant Human PODN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PODN-3060HCL | Recombinant Human PODN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PODN Products
Required fields are marked with *
My Review for All PODN Products
Required fields are marked with *
0
Inquiry Basket