Recombinant Full Length Human POLR3H Protein, C-Flag-tagged
| Cat.No. : | POLR3H-976HFL | 
| Product Overview : | Recombinant Full Length Human POLR3H Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Enables DNA-directed 5'-3' RNA polymerase activity. Involved in transcription by RNA polymerase III. Located in centrosome and nucleoplasm. Part of RNA polymerase III complex. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 22.7 kDa | 
| AA Sequence : | MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKV HFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDL YMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Transcription Factors | 
| Protein Pathways : | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase | 
| Full Length : | Full L. | 
| Gene Name | POLR3H RNA polymerase III subunit H [ Homo sapiens (human) ] | 
| Official Symbol | POLR3H | 
| Synonyms | C25; RPC8; RPC22.9 | 
| Gene ID | 171568 | 
| mRNA Refseq | NM_001018050.4 | 
| Protein Refseq | NP_001018060.1 | 
| MIM | 619801 | 
| UniProt ID | Q9Y535 | 
| ◆ Recombinant Proteins | ||
| POLR3H-1732H | Recombinant Human POLR3H Protein, His (Fc)-Avi-tagged | +Inquiry | 
| POLR3H-3523R | Recombinant Rhesus monkey POLR3H Protein, His-tagged | +Inquiry | 
| POLR3H-606Z | Recombinant Zebrafish POLR3H | +Inquiry | 
| POLR3H-5994H | Recombinant Human POLR3H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| POLR3H-6934M | Recombinant Mouse POLR3H Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| POLR3H-3022HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry | 
| POLR3H-3021HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR3H Products
Required fields are marked with *
My Review for All POLR3H Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            