Recombinant Full Length Human Popeye Domain-Containing Protein 3(Popdc3) Protein, His-Tagged
Cat.No. : | RFL4280HF |
Product Overview : | Recombinant Full Length Human Popeye domain-containing protein 3(POPDC3) Protein (Q9HBV1) (1-291aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-291) |
Form : | Lyophilized powder |
AA Sequence : | MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | POPDC3 |
Synonyms | POPDC3; POP3; Popeye domain-containing protein 3; Popeye protein 3 |
UniProt ID | Q9HBV1 |
◆ Recombinant Proteins | ||
POPDC3-3347R | Recombinant Rhesus Macaque POPDC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
POPDC3-13129M | Recombinant Mouse POPDC3 Protein | +Inquiry |
POPDC3-257Z | Recombinant Zebrafish POPDC3 | +Inquiry |
POPDC3-6263C | Recombinant Chicken POPDC3 | +Inquiry |
POPDC3-1862H | Recombinant Human POPDC3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POPDC3-3007HCL | Recombinant Human POPDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POPDC3 Products
Required fields are marked with *
My Review for All POPDC3 Products
Required fields are marked with *
0
Inquiry Basket