Recombinant Full Length Human Potassium Channel Subfamily K Member 18(Kcnk18) Protein, His-Tagged
Cat.No. : | RFL7592HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 18(KCNK18) Protein (Q7Z418) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN RLIDIYKNVMLFFAKGKFYHLVKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK18 |
Synonyms | KCNK18; TRESK; TRIK; Potassium channel subfamily K member 18; TWIK-related individual potassium channel; TWIK-related spinal cord potassium channel |
UniProt ID | Q7Z418 |
◆ Recombinant Proteins | ||
KCNK18-4746M | Recombinant Mouse KCNK18 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNK18-3927H | Recombinant Human KCNK18 protein, His-tagged | +Inquiry |
RFL14104RF | Recombinant Full Length Rat Potassium Channel Subfamily K Member 18(Kcnk18) Protein, His-Tagged | +Inquiry |
KCNK18-8530M | Recombinant Mouse KCNK18 Protein | +Inquiry |
KCNK18-3211R | Recombinant Rat KCNK18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK18-5037HCL | Recombinant Human KCNK18 293 Cell Lysate | +Inquiry |
KCNK18-925HCL | Recombinant Human KCNK18 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK18 Products
Required fields are marked with *
My Review for All KCNK18 Products
Required fields are marked with *
0
Inquiry Basket