Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily E Member 2(Kcne2) Protein, His-Tagged
Cat.No. : | RFL15162HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily E member 2(KCNE2) Protein (Q9Y6J6) (1-123aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-123aa) |
Form : | Lyophilized powder |
AA Sequence : | MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNE2 |
Synonyms | KCNE2; Potassium voltage-gated channel subfamily E member 2; MinK-related peptide 1; Minimum potassium ion channel-related peptide 1; Potassium channel subunit beta MiRP1 |
UniProt ID | Q9Y6J6 |
◆ Recombinant Proteins | ||
KCNE2-2834R | Recombinant Rat KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Kcne2-3130R | Recombinant Rat Kcne2 protein, His-tagged | +Inquiry |
KCNE2-2853H | Recombinant Human KCNE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL15162HF | Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily E Member 2(Kcne2) Protein, His-Tagged | +Inquiry |
Kcne2-3655M | Recombinant Mouse Kcne2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNE2-5065HCL | Recombinant Human KCNE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNE2 Products
Required fields are marked with *
My Review for All KCNE2 Products
Required fields are marked with *
0
Inquiry Basket