Recombinant Full Length Human PPBP Protein
Cat.No. : | PPBP-29720TH |
Product Overview : | Recombinant full length Human NAP2 expressed in Saccharomyces cerevisiae; 128 amino acids, MWt 13.9 kDa. 25 kDa proprietary tag is attached. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-128 a.a. |
Description : | The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQ TKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQ SLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Sequence Similarities : | Belongs to the intercrine alpha (chemokine CxC) family. |
Full Length : | Full L. |
Gene Name | PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens ] |
Official Symbol | PPBP |
Synonyms | PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil act |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
Uniprot ID | P02775 |
Chromosome Location | 4q12-q13 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function | chemokine activity; glucose transmembrane transporter activity; growth factor activity; |
◆ Recombinant Proteins | ||
PPBP-29720TH | Recombinant Full Length Human PPBP Protein | +Inquiry |
PPBP-068P | Active Recombinant Human PPBP Protein (70 aa) | +Inquiry |
Ppbp-448R | Active Recombinant Rat Pro-Platelet Basic Protein (chemokine (C-X-C motif) ligand 7) | +Inquiry |
Ppbp-518M | Recombinant Mouse Ppbp Protein, His-tagged | +Inquiry |
Ppbp-287M | Active Recombinant Mouse Ppbp | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
0
Inquiry Basket