Recombinant Full Length Human PPBP Protein

Cat.No. : PPBP-29720TH
Product Overview : Recombinant full length Human NAP2 expressed in Saccharomyces cerevisiae; 128 amino acids, MWt 13.9 kDa. 25 kDa proprietary tag is attached.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-128 a.a.
Description : The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQ TKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQ SLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Sequence Similarities : Belongs to the intercrine alpha (chemokine CxC) family.
Full Length : Full L.
Gene Name PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens ]
Official Symbol PPBP
Synonyms PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil act
Gene ID 5473
mRNA Refseq NM_002704
Protein Refseq NP_002695
MIM 121010
Uniprot ID P02775
Chromosome Location 4q12-q13
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function chemokine activity; glucose transmembrane transporter activity; growth factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPBP Products

Required fields are marked with *

My Review for All PPBP Products

Required fields are marked with *

0
cart-icon
0
compare icon