Recombinant Full Length Human PPP1R1A Protein, C-Flag-tagged

• Cat.No.: PPP1R1A-697HFL
• Product Overview: Recombinant Full Length Human PPP1R1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable protein serine/threonine phosphatase inhibitor activity. Predicted to be involved in intracellular signal transduction. Predicted to be active in cytoplasm.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.8 kDa
• AA Sequence: MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI
  PKTHERGSKEPSTKEPSTHIPPLDSKGANSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Long-term potentiation
• Full Length: Full L.

Gene Information

• Gene Name: PPP1R1A protein phosphatase 1 regulatory inhibitor subunit 1A [ Homo sapiens (human) ]
• Official Symbol: PPP1R1A
• Synonyms: I1; IPP1
• Gene ID: 5502
• mRNA Refseq: NM_006741.4
• Protein Refseq: NP_006732.3
• MIM: 613246
• UniProt ID: Q13522