Recombinant Full Length Human PPP1R1A Protein, C-Flag-tagged
Cat.No. : | PPP1R1A-697HFL |
Product Overview : | Recombinant Full Length Human PPP1R1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable protein serine/threonine phosphatase inhibitor activity. Predicted to be involved in intracellular signal transduction. Predicted to be active in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI PKTHERGSKEPSTKEPSTHIPPLDSKGANSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Long-term potentiation |
Full Length : | Full L. |
Gene Name | PPP1R1A protein phosphatase 1 regulatory inhibitor subunit 1A [ Homo sapiens (human) ] |
Official Symbol | PPP1R1A |
Synonyms | I1; IPP1 |
Gene ID | 5502 |
mRNA Refseq | NM_006741.4 |
Protein Refseq | NP_006732.3 |
MIM | 613246 |
UniProt ID | Q13522 |
◆ Recombinant Proteins | ||
PPP1R1A-4646H | Recombinant Human PPP1R1A protein, His-tagged | +Inquiry |
PPP1R1A-1748H | Recombinant Human PPP1R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R1A-341H | Recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1A, His-tagged | +Inquiry |
PPP1R1A-13228M | Recombinant Mouse PPP1R1A Protein | +Inquiry |
PPP1R1A-697HFL | Recombinant Full Length Human PPP1R1A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R1A-2941HCL | Recombinant Human PPP1R1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1A Products
Required fields are marked with *
My Review for All PPP1R1A Products
Required fields are marked with *
0
Inquiry Basket