Recombinant Full Length Human PPP1R27 Protein, GST-tagged

Cat.No. : PPP1R27-4094HF
Product Overview : Human DYSFIP1 full-length ORF ( NP_001007534.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 154 amino acids
Description : PPP1R27 (Protein Phosphatase 1 Regulatory Subunit 27) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity. An important paralog of this gene is NRARP.
Molecular Mass : 43.8 kDa
AA Sequence : MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PPP1R27 protein phosphatase 1 regulatory subunit 27 [ Homo sapiens (human) ]
Official Symbol PPP1R27
Synonyms PPP1R27; protein phosphatase 1 regulatory subunit 27; Protein Phosphatase 1 Regulatory Subunit 27; Dysferlin-Interacting Protein 1 (Toonin); Dysferlin Interacting Protein 1; DYSFIP1; Toonin; Protein Phosphatase 1, Regulatory Subunit 27; Dysferlin Interacting Protein 1 (Toonin); Dysferlin-Interacting Protein 1; protein phosphatase 1 regulatory subunit 27; dysferlin interacting protein 1; dysferlin-interacting protein 1 (toonin); toonin
Gene ID 116729
mRNA Refseq NM_001007533
Protein Refseq NP_001007534
UniProt ID Q86WC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R27 Products

Required fields are marked with *

My Review for All PPP1R27 Products

Required fields are marked with *

0
cart-icon
0
compare icon