Recombinant Full Length Human PQLC2L Protein, GST-tagged

• Cat.No.: PQLC2L-3860HF
• Product Overview: Human C3orf55 full-length ORF ( ADR82799.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 118 amino acids
• Description: PQLC2L (PQ Loop Repeat Containing 2 Like) is a Protein Coding gene. An important paralog of this gene is PQLC2.
• Molecular Mass: 13 kDa
• AA Sequence: MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPIQIFTAIFDMNTDVIILSQFMYYRLKNQKKKISEEDLRKELHFCCLHWP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PQLC2L PQ loop repeat containing 2 like [ Homo sapiens (human) ]
• Official Symbol: PQLC2L
• Synonyms: PQLC2L; PQ loop repeat containing 2 like; C3orf55; putative uncharacterized protein PQLC2L; PQ-loop repeat-containing protein 2-like; PQ Loop Repeat Containing 2 Like 2; PQ-Loop Repeat-Containing Protein 2-Like; Putative Uncharacterized Protein PQLC2L; Chromosome 3 Open Reading Frame 55
• Gene ID: 152078
• mRNA Refseq: NM_001099777
• Protein Refseq: NP_001093247
• UniProt ID: A1A4F0