Recombinant Human PQLC2L Protein, GST-tagged
Cat.No. : | PQLC2L-5226H |
Product Overview : | Human C3orf55 full-length ORF ( ADR82799.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PQLC2L (PQ Loop Repeat Containing 2 Like) is a Protein Coding gene. An important paralog of this gene is PQLC2. |
Molecular Mass : | 13 kDa |
AA Sequence : | MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPIQIFTAIFDMNTDVIILSQFMYYRLKNQKKKISEEDLRKELHFCCLHWP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PQLC2L PQ loop repeat containing 2 like [ Homo sapiens (human) ] |
Official Symbol | PQLC2L |
Synonyms | PQLC2L; PQ loop repeat containing 2 like; C3orf55; putative uncharacterized protein PQLC2L; PQ-loop repeat-containing protein 2-like; PQ Loop Repeat Containing 2 Like 2; PQ-Loop Repeat-Containing Protein 2-Like; Putative Uncharacterized Protein PQLC2L; Chromosome 3 Open Reading Frame 55 |
Gene ID | 152078 |
mRNA Refseq | NM_001099777 |
Protein Refseq | NP_001093247 |
UniProt ID | A1A4F0 |
◆ Recombinant Proteins | ||
PQLC2L-3860HF | Recombinant Full Length Human PQLC2L Protein, GST-tagged | +Inquiry |
PQLC2L-5226H | Recombinant Human PQLC2L Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PQLC2L Products
Required fields are marked with *
My Review for All PQLC2L Products
Required fields are marked with *