Recombinant Full Length Human PRCP Protein, GST-tagged
Cat.No. : | PRCP-31107TH |
Product Overview : | Recombinant full length Human PRCP with N terminal proprietary tag; Predicted MW 80.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-496 a.a. |
Description : | The protein encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Molecular Weight : | 80.630kDa inclusive of tags |
Tissue specificity : | Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTS LPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWK KNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKH LKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGAL AASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSD SLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGV RPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKD ITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH MKNWIRDFYDSAGKQH |
Sequence Similarities : | Belongs to the peptidase S28 family. |
Gene Name | PRCP prolylcarboxypeptidase (angiotensinase C) [ Homo sapiens ] |
Official Symbol | PRCP |
Synonyms | PRCP; prolylcarboxypeptidase (angiotensinase C); lysosomal Pro-X carboxypeptidase; HUMPCP; PCP; |
Gene ID | 5547 |
mRNA Refseq | NM_005040 |
Protein Refseq | NP_005031 |
MIM | 176785 |
Uniprot ID | P42785 |
Chromosome Location | 11q14 |
Pathway | Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Hemostasis, organism-specific biosystem; Intrinsic Pathway, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; protein binding; serine-type carboxypeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
PRCP-06H | Active Recombinant Human PRCP protein, His-tagged | +Inquiry |
PRCP-6727H | Recombinant Human PRCP protein, His & T7-tagged | +Inquiry |
PRCP-5975H | Recombinant Human PRCP Protein (Asp108-Val376), N-His tagged | +Inquiry |
PRCP-798Z | Recombinant Zebrafish PRCP | +Inquiry |
PRCP-3405R | Recombinant Rhesus Macaque PRCP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRCP-2889HCL | Recombinant Human PRCP 293 Cell Lysate | +Inquiry |
PRCP-2888HCL | Recombinant Human PRCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRCP Products
Required fields are marked with *
My Review for All PRCP Products
Required fields are marked with *