Recombinant Full Length Human PRKRA Protein, C-Flag-tagged
Cat.No. : | PRKRA-1175HFL |
Product Overview : | Recombinant Full Length Human PRKRA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP ITVCHGSGISCGNAQSDAAHNALQYLKIIAERKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PRKRA protein activator of interferon induced protein kinase EIF2AK2 [ Homo sapiens (human) ] |
Official Symbol | PRKRA |
Synonyms | RAX; PACT; DYT16; HSD14 |
Gene ID | 8575 |
mRNA Refseq | NM_003690.5 |
Protein Refseq | NP_003681.1 |
MIM | 603424 |
UniProt ID | O75569 |
◆ Recombinant Proteins | ||
PRKRA-4345R | Recombinant Rat PRKRA Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKRA-2502B | Recombinant Bovine PRKRA Protein (1-313 aa), His-Myc-tagged | +Inquiry |
PRKRA-654H | Recombinant Human PRKRA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRKRA-4686R | Recombinant Rat PRKRA Protein | +Inquiry |
PRKRA-3427R | Recombinant Rhesus Macaque PRKRA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKRA-2848HCL | Recombinant Human PRKRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKRA Products
Required fields are marked with *
My Review for All PRKRA Products
Required fields are marked with *