Recombinant Full Length Human Probable G-Protein Coupled Receptor 85(Gpr85) Protein, His-Tagged
Cat.No. : | RFL25445HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 85(GPR85) Protein (P60893) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR85 |
Synonyms | GPR85; SREB2; Probable G-protein coupled receptor 85; Super conserved receptor expressed in brain 2 |
UniProt ID | P60893 |
◆ Recombinant Proteins | ||
RFL30704RF | Recombinant Full Length Rat Probable G-Protein Coupled Receptor 85(Gpr85) Protein, His-Tagged | +Inquiry |
GPR85-9050Z | Recombinant Zebrafish GPR85 | +Inquiry |
GPR85-5496HF | Recombinant Full Length Human GPR85 Protein, GST-tagged | +Inquiry |
GPR85-6617H | Recombinant Human GPR85 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPR85-2670R | Recombinant Rat GPR85 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR85-5774HCL | Recombinant Human GPR85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR85 Products
Required fields are marked with *
My Review for All GPR85 Products
Required fields are marked with *
0
Inquiry Basket