Recombinant Full Length Human Probable N-Acetyltransferase 8(Nat8) Protein, His-Tagged
Cat.No. : | RFL7580HF |
Product Overview : | Recombinant Full Length Human Probable N-acetyltransferase 8(NAT8) Protein (Q9UHE5) (1-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-227) |
Form : | Lyophilized powder |
AA Sequence : | MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NAT8 |
Synonyms | NAT8; CML1; GLA; TSC501; N-acetyltransferase 8; Acetyltransferase 2; ATase2; Camello-like protein 1; Cysteinyl-conjugate N-acetyltransferase; CCNAT |
UniProt ID | Q9UHE5 |
◆ Recombinant Proteins | ||
NAT8-3567R | Recombinant Rat NAT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT8-3908R | Recombinant Rat NAT8 Protein | +Inquiry |
NAT8-1195H | Recombinant Human NAT8, GST-tagged | +Inquiry |
Nat8-6383M | Recombinant Mouse Nat8 Protein (Ser57-Leu227), N-His tagged | +Inquiry |
RFL20555MF | Recombinant Full Length Mouse N-Acetyltransferase 8(Nat8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT8-3962HCL | Recombinant Human NAT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT8 Products
Required fields are marked with *
My Review for All NAT8 Products
Required fields are marked with *