Recombinant Full Length Human Protein Mpv17(Mpv17) Protein, His-Tagged
| Cat.No. : | RFL27848HF |
| Product Overview : | Recombinant Full Length Human Protein Mpv17(MPV17) Protein (P39210) (1-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-176) |
| Form : | Lyophilized powder |
| AA Sequence : | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MPV17 |
| Synonyms | Glomerulosclerosis; Mpv17; Mpv17 human homolog of glomerulosclerosis and nephrotic syndrome; MpV17 mitochondrial inner membrane protein; MPV17_HUMAN; MTDPS6; Protein Mpv17; SYM1 |
| UniProt ID | P39210 |
| ◆ Recombinant Proteins | ||
| MPV17-5656M | Recombinant Mouse MPV17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL33288BF | Recombinant Full Length Bovine Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
| MPV17-11382Z | Recombinant Zebrafish MPV17 | +Inquiry |
| MPV17-5522H | Recombinant Human MPV17 Protein, GST-tagged | +Inquiry |
| MPV17-662H | Recombinant Human MPV17 Protein (1-176 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPV17 Products
Required fields are marked with *
My Review for All MPV17 Products
Required fields are marked with *


