Recombinant Human MPV17 Protein (1-176 aa), His-SUMO-tagged
Cat.No. : | MPV17-662H |
Product Overview : | Recombinant Human MPV17 Protein (1-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-176 aa |
Description : | Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ] |
Official Symbol | MPV17 |
Synonyms | MPV17; protein Mpv17; glomerulosclerosis; SYM1; MTDPS6; |
Gene ID | 4358 |
mRNA Refseq | NM_002437 |
Protein Refseq | NP_002428 |
MIM | 137960 |
UniProt ID | P39210 |
◆ Recombinant Proteins | ||
MPV17-28635TH | Recombinant Human MPV17 | +Inquiry |
MPV17-2818R | Recombinant Rhesus monkey MPV17 Protein, His-tagged | +Inquiry |
MPV17-11382Z | Recombinant Zebrafish MPV17 | +Inquiry |
RFL33288BF | Recombinant Full Length Bovine Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
RFL27848HF | Recombinant Full Length Human Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPV17 Products
Required fields are marked with *
My Review for All MPV17 Products
Required fields are marked with *
0
Inquiry Basket