Recombinant Human MPV17 Protein (1-176 aa), His-SUMO-tagged

Cat.No. : MPV17-662H
Product Overview : Recombinant Human MPV17 Protein (1-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-176 aa
Description : Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 35.7 kDa
AA Sequence : MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ]
Official Symbol MPV17
Synonyms MPV17; protein Mpv17; glomerulosclerosis; SYM1; MTDPS6;
Gene ID 4358
mRNA Refseq NM_002437
Protein Refseq NP_002428
MIM 137960
UniProt ID P39210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPV17 Products

Required fields are marked with *

My Review for All MPV17 Products

Required fields are marked with *

0
cart-icon