Recombinant Full Length Human Protein Transport Protein Sec61 Subunit Gamma(Sec61G) Protein, His-Tagged
Cat.No. : | RFL29673HF |
Product Overview : | Recombinant Full Length Human Protein transport protein Sec61 subunit gamma(SEC61G) Protein (P60059) (1-68aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-68) |
Form : | Lyophilized powder |
AA Sequence : | MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SEC61G |
Synonyms | SEC61G; Protein transport protein Sec61 subunit gamma |
UniProt ID | P60059 |
◆ Recombinant Proteins | ||
RFL27152MF | Recombinant Full Length Mouse Protein Transport Protein Sec61 Subunit Gamma(Sec61G) Protein, His-Tagged | +Inquiry |
SEC61G-4129R | Recombinant Rhesus monkey SEC61G Protein, His-tagged | +Inquiry |
SEC61G-627Z | Recombinant Zebrafish SEC61G | +Inquiry |
SEC61G-7992M | Recombinant Mouse SEC61G Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC61G-14841M | Recombinant Mouse SEC61G Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC61G-1989HCL | Recombinant Human SEC61G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC61G Products
Required fields are marked with *
My Review for All SEC61G Products
Required fields are marked with *