Recombinant Full Length Human Protein Yipf2(Yipf2) Protein, His-Tagged
Cat.No. : | RFL17667HF |
Product Overview : | Recombinant Full Length Human Protein YIPF2(YIPF2) Protein (Q9BWQ6) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEES DKAALLQEQQQQQQPGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPD LYGPFWICATLAFVLAVTGNLTLVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLAL WGFLRWRKGVQERMGPYTFLETVCIYGYSLFVFIPMVVLWLIPVPWLQWLFGALALGLSA AGLVFTLWPVVREDTRLVATVLLSVVVLLHALLAMGCKLYFFQSLPPENVAPPPQITSLP SNIALSPTLPQSLAPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIPF2 |
Synonyms | YIPF2; Protein YIPF2; YIP1 family member 2 |
UniProt ID | Q9BWQ6 |
◆ Recombinant Proteins | ||
YIPF2-6627R | Recombinant Rat YIPF2 Protein | +Inquiry |
YIPF2-6283R | Recombinant Rat YIPF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
YIPF2-10256M | Recombinant Mouse YIPF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17667HF | Recombinant Full Length Human Protein Yipf2(Yipf2) Protein, His-Tagged | +Inquiry |
Yipf2-7033M | Recombinant Mouse Yipf2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIPF2-738HCL | Recombinant Human YIPF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YIPF2 Products
Required fields are marked with *
My Review for All YIPF2 Products
Required fields are marked with *
0
Inquiry Basket