Recombinant Full Length Human PRPH Protein, C-Flag-tagged
Cat.No. : | PRPH-397HFL |
Product Overview : | Recombinant Full Length Human PRPH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGAL LRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARA DQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLFRKDVDDATLS RLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNL QEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS) |
Full Length : | Full L. |
Gene Name | PRPH peripherin [ Homo sapiens (human) ] |
Official Symbol | PRPH |
Synonyms | NEF4; PRPH1 |
Gene ID | 5630 |
mRNA Refseq | NM_006262.4 |
Protein Refseq | NP_006253.2 |
MIM | 170710 |
UniProt ID | P41219 |
◆ Recombinant Proteins | ||
PRPH-405HF | Recombinant Full Length Human PRPH Protein | +Inquiry |
PRPH-4227H | Recombinant Human PRPH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Prph-5150M | Recombinant Mouse Prph Protein, Myc/DDK-tagged | +Inquiry |
PRPH-30642TH | Recombinant Human PRPH | +Inquiry |
PRPH-397HFL | Recombinant Full Length Human PRPH Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPH-2822HCL | Recombinant Human PRPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPH Products
Required fields are marked with *
My Review for All PRPH Products
Required fields are marked with *
0
Inquiry Basket