Recombinant Full Length Human PRPSAP1 Protein, C-Flag-tagged
Cat.No. : | PRPSAP1-2134HFL |
Product Overview : | Recombinant Full Length Human PRPSAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Predicted to be involved in 5-phosphoribose 1-diphosphate biosynthetic process and purine nucleotide biosynthetic process. Predicted to be part of ribose phosphate diphosphokinase complex. Predicted to be active in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDV NTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEI QGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMD DGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKI YVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFR NITVDD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PRPSAP1 phosphoribosyl pyrophosphate synthetase associated protein 1 [ Homo sapiens (human) ] |
Official Symbol | PRPSAP1 |
Synonyms | PAP39 |
Gene ID | 5635 |
mRNA Refseq | NM_002766.3 |
Protein Refseq | NP_002757.2 |
MIM | 601249 |
UniProt ID | Q14558 |
◆ Recombinant Proteins | ||
PRPSAP1-3627R | Recombinant Rhesus monkey PRPSAP1 Protein, His-tagged | +Inquiry |
PRPSAP1-1777H | Recombinant Human PRPSAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPSAP1-3445R | Recombinant Rhesus Macaque PRPSAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPSAP1-1984H | Recombinant Human PRPSAP1, GST-tagged | +Inquiry |
Prpsap1-5153M | Recombinant Mouse Prpsap1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPSAP1-2819HCL | Recombinant Human PRPSAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPSAP1 Products
Required fields are marked with *
My Review for All PRPSAP1 Products
Required fields are marked with *
0
Inquiry Basket