Recombinant Full Length Human PSG1 Protein
| Cat.No. : | PSG1-401HF |
| Product Overview : | Recombinant full length Human Pregnancy Specific Glycoprotein 1, isoform 4 with N terminal proprietary tag; Predicted MWt 69.23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 392 amino acids |
| Description : | The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al. |
| Form : | Liquid |
| Molecular Mass : | 69.230kDa inclusive of tags |
| AA Sequence : | QVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRD LYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTR EDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSS NLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLK LSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWW LNGQSLPVSPRVRRPIENRILILPSVTRNETGPYQCEIRD RYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSC SADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVC SVRNSATGKESSKSMTVEVSGKWIPASLAIGF |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PSG1 pregnancy specific beta-1-glycoprotein 1 [ Homo sapiens ] |
| Official Symbol | PSG1 |
| Synonyms | PSG1; pregnancy specific beta-1-glycoprotein 1; PSBG1; pregnancy-specific beta-1-glycoprotein 1; CD66f; PBG1; PSGGA |
| Gene ID | 5669 |
| mRNA Refseq | NM_001184825 |
| Protein Refseq | NP_001171754 |
| MIM | 176390 |
| UniProt ID | P11464 |
| ◆ Recombinant Proteins | ||
| PSG1-1376H | Recombinant Human PSG1 Protein (Leu202-Thr401), N-His tagged | +Inquiry |
| PSG1-696HFL | Active Recombinant Full Length Human PSG1 Protein, C-Flag-tagged | +Inquiry |
| PSG1-401HF | Recombinant Full Length Human PSG1 Protein | +Inquiry |
| PSG1-6025H | Recombinant Human PSG1 Protein (Gln35-Pro419), C-His tagged | +Inquiry |
| PSG1-30615TH | Recombinant Human PSG1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSG1-2788HCL | Recombinant Human PSG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSG1 Products
Required fields are marked with *
My Review for All PSG1 Products
Required fields are marked with *
