Recombinant Full Length Human PTDSS1 Protein, C-Flag-tagged
Cat.No. : | PTDSS1-2014HFL |
Product Overview : | Recombinant Full Length Human PTDSS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes to the mitochondria-associated membrane of the endoplasmic reticulum, where it serves a structural role as well as a signaling role. Defects in this gene are a cause of Lenz-Majewski hyperostotic dwarfism. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRDDSVPEDNIW RGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLFLNFEQVKSLMYWLDPNLRYA TREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKALLIRSYGLCWTISITWELTELFFMHLLPNF AECWWDQVILDILLCNGGGIWLGMVVCRFLEMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDP KSSFQRVAGVYLFMIIWQLTELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRV GTQCWVFGVIGFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECE DGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Glycerophospholipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens (human) ] |
Official Symbol | PTDSS1 |
Synonyms | LMHD; PSS1; PSSA |
Gene ID | 9791 |
mRNA Refseq | NM_014754.3 |
Protein Refseq | NP_055569.1 |
MIM | 612792 |
UniProt ID | P48651 |
◆ Recombinant Proteins | ||
PTDSS1-3151C | Recombinant Chicken PTDSS1 | +Inquiry |
PTDSS1-3503R | Recombinant Rhesus Macaque PTDSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18343GF | Recombinant Full Length Chicken Phosphatidylserine Synthase 2(Ptdss1) Protein, His-Tagged | +Inquiry |
Ptdss1-5215M | Recombinant Mouse Ptdss1 Protein, Myc/DDK-tagged | +Inquiry |
PTDSS1-1791H | Recombinant Human PTDSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTDSS1-2722HCL | Recombinant Human PTDSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTDSS1 Products
Required fields are marked with *
My Review for All PTDSS1 Products
Required fields are marked with *
0
Inquiry Basket