Recombinant Full Length Human PTGES3 Protein (1-160 aa), His-tagged

Cat.No. : PTGES3-2568H
Product Overview : Recombinant Human PTGES3 Protein (1-160 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-160 aa
Description : Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.2 kDa
AA Sequence : MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name PTGES3 prostaglandin E synthase 3 (cytosolic) [ Homo sapiens ]
Official Symbol PTGES3
Synonyms PTGES3; prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; P23;
Gene ID 10728
mRNA Refseq NM_006601
Protein Refseq NP_006592
MIM 607061
UniProt ID Q15185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGES3 Products

Required fields are marked with *

My Review for All PTGES3 Products

Required fields are marked with *

0
cart-icon