Recombinant Full Length Human PTGES3 Protein (1-160 aa), His-tagged
Cat.No. : | PTGES3-2568H |
Product Overview : | Recombinant Human PTGES3 Protein (1-160 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-160 aa |
Description : | Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.2 kDa |
AA Sequence : | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PTGES3 prostaglandin E synthase 3 (cytosolic) [ Homo sapiens ] |
Official Symbol | PTGES3 |
Synonyms | PTGES3; prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; P23; |
Gene ID | 10728 |
mRNA Refseq | NM_006601 |
Protein Refseq | NP_006592 |
MIM | 607061 |
UniProt ID | Q15185 |
◆ Recombinant Proteins | ||
PTGES3-13642M | Recombinant Mouse PTGES3 Protein | +Inquiry |
PTGES3-301648H | Recombinant Full Length Human PTGES3 protein, GST-tagged | +Inquiry |
Ptges3-5221M | Recombinant Mouse Ptges3 Protein, Myc/DDK-tagged | +Inquiry |
PTGES3-30054TH | Recombinant Human PTGES3 | +Inquiry |
PTGES3-4508H | Recombinant Human PTGES3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGES3-2712HCL | Recombinant Human PTGES3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGES3 Products
Required fields are marked with *
My Review for All PTGES3 Products
Required fields are marked with *
0
Inquiry Basket