Recombinant Full Length Human PTGR2 Protein, C-Flag-tagged
Cat.No. : | PTGR2-1260HFL |
Product Overview : | Recombinant Full Length Human PTGR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS LTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PTGR2 prostaglandin reductase 2 [ Homo sapiens (human) ] |
Official Symbol | PTGR2 |
Synonyms | PGR2; ZADH1; HEL-S-298 |
Gene ID | 145482 |
mRNA Refseq | NM_152444.4 |
Protein Refseq | NP_689657.1 |
MIM | 608642 |
UniProt ID | Q8N8N7 |
◆ Recombinant Proteins | ||
PTGR2-4474R | Recombinant Rat PTGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ptgr2-5224M | Recombinant Mouse Ptgr2 Protein, Myc/DDK-tagged | +Inquiry |
PTGR2-4815R | Recombinant Rat PTGR2 Protein | +Inquiry |
PTGR2-8134Z | Recombinant Zebrafish PTGR2 | +Inquiry |
PTGR2-5143H | Recombinant Human PTGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGR2-2707HCL | Recombinant Human PTGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGR2 Products
Required fields are marked with *
My Review for All PTGR2 Products
Required fields are marked with *
0
Inquiry Basket