Recombinant Full Length Human PTP4A3 Protein, C-Flag-tagged

Cat.No. : PTP4A3-719HFL
Product Overview : Recombinant Full Length Human PTP4A3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19.4 kDa
AA Sequence : MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA
INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Phosphatase
Full Length : Full L.
Gene Name PTP4A3 protein tyrosine phosphatase 4A3 [ Homo sapiens (human) ]
Official Symbol PTP4A3
Synonyms PRL3; PRL-3; PRL-R
Gene ID 11156
mRNA Refseq NM_032611.3
Protein Refseq NP_116000.1
MIM 606449
UniProt ID O75365

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTP4A3 Products

Required fields are marked with *

My Review for All PTP4A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon