Recombinant Full Length Human PTPRA Protein, C-Flag-tagged
Cat.No. : | PTPRA-2157HFL |
Product Overview : | Recombinant Full Length Human PTPRA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 87.6 kDa |
AA Sequence : | MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDE TPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYP PLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEG VPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGC WTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKA CNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALL EHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIP YEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG QEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM ISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLE QYEFCYKVVQEYIDAFSDYANFK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase, Transmembrane |
Full Length : | Full L. |
Gene Name | PTPRA protein tyrosine phosphatase receptor type A [ Homo sapiens (human) ] |
Official Symbol | PTPRA |
Synonyms | LRP; HLPR; PTPA; HEPTP; HPTPA; RPTPA; PTPRL2; HPTPalpha; R-PTP-alpha |
Gene ID | 5786 |
mRNA Refseq | NM_080841.3 |
Protein Refseq | NP_543031.1 |
MIM | 176884 |
UniProt ID | P18433 |
◆ Recombinant Proteins | ||
PTPRA-1521H | Active Recombinant Human PTPRA, GST-tagged | +Inquiry |
PTPRA-2157HFL | Recombinant Full Length Human PTPRA Protein, C-Flag-tagged | +Inquiry |
PTPRA-1803H | Recombinant Human PTPRA Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPRA-9392Z | Recombinant Zebrafish PTPRA | +Inquiry |
Ptpra-8106R | Recombinant Rat Ptpra protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRA-503HCL | Recombinant Human PTPRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRA Products
Required fields are marked with *
My Review for All PTPRA Products
Required fields are marked with *
0
Inquiry Basket