Recombinant Full Length Human PTS Protein, Flag tagged

• Cat.No.: PTS-32HFL
• Product Overview: Recombinant protein of human 6-pyruvoyltetrahydropterin synthase (PTS) with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-145 aa
• Description: The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 16.2 kDa
• AASequence: MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIVVYKGETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: PTS 6-pyruvoyltetrahydropterin synthase [ Homo sapiens (human) ]
• Official Symbol: PTS
• Synonyms: PTS; PTPS; 6-pyruvoyltetrahydropterin synthase; 6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; EC 4.2.3.12
• Gene ID: 5805
• mRNA Refseq: NM_000317
• Protein Refseq: NP_000308
• MIM: 612719
• UniProt ID: Q03393