Recombinant Full Length Human PYY Protein

• Cat.No.: PYY-417HF
• Product Overview: Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 97 amino acids
• Description: The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity.
• Form: Liquid
• Molecular Mass: 36.740kDa inclusive of tags
• AA Sequence: MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PYY peptide YY [ Homo sapiens ]
• Official Symbol: PYY
• Synonyms: PYY; peptide YY; PYY1
• Gene ID: 5697
• mRNA Refseq: NM_004160
• Protein Refseq: NP_004151
• MIM: 606838
• UniProt ID: P10082