Recombinant Full Length Human PYY Protein

Cat.No. : PYY-417HF
Product Overview : Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 97 amino acids
Description : The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity.
Form : Liquid
Molecular Mass : 36.740kDa inclusive of tags
AA Sequence : MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PYY peptide YY [ Homo sapiens ]
Official Symbol PYY
Synonyms PYY; peptide YY; PYY1
Gene ID 5697
mRNA Refseq NM_004160
Protein Refseq NP_004151
MIM 606838
UniProt ID P10082

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYY Products

Required fields are marked with *

My Review for All PYY Products

Required fields are marked with *

0
cart-icon
0
compare icon