| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Flag |
| Protein Length : |
1-97 aa |
| Description : |
This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. |
| Form : |
25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Molecular Mass : |
11 kDa |
| AASequence : |
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : |
> 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : |
For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage : |
Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Concentration : |
>0.05 μg/μL as determined by microplate BCA method |
| Shipping : |
Dry ice |
