Recombinant Full Length Human PYY Protein, GST tagged

Cat.No. : PYY-29935TH
Product Overview : Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 1-97 a.a.
Description : The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Sequence Similarities : Belongs to the NPY family.
Gene Name PYY peptide YY [ Homo sapiens ]
Official Symbol PYY
Synonyms PYY; peptide YY; PYY1;
Gene ID 5697
mRNA Refseq NM_004160
Protein Refseq NP_004151
Uniprot ID P10082
Chromosome Location 17q21.1
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem;
Function hormone activity; neuropeptide hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYY Products

Required fields are marked with *

My Review for All PYY Products

Required fields are marked with *

0
cart-icon
0
compare icon