Recombinant Full Length Human PYY Protein, GST tagged
Cat.No. : | PYY-29935TH |
Product Overview : | Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 1-97 a.a. |
Description : | The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity. |
Molecular Weight : | 36.740kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
Sequence Similarities : | Belongs to the NPY family. |
Gene Name | PYY peptide YY [ Homo sapiens ] |
Official Symbol | PYY |
Synonyms | PYY; peptide YY; PYY1; |
Gene ID | 5697 |
mRNA Refseq | NM_004160 |
Protein Refseq | NP_004151 |
Uniprot ID | P10082 |
Chromosome Location | 17q21.1 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; |
Function | hormone activity; neuropeptide hormone activity; |
◆ Recombinant Proteins | ||
PYY-2831H | Recombinant Human PYY Protein, His-tagged, OVA Conjugated | +Inquiry |
PYY-3398H | Recombinant Human PYY protein, His-tagged | +Inquiry |
PYY-2088H | Recombinant Human PYY, His-tagged | +Inquiry |
PYY-4811M | Recombinant Mouse PYY Protein, His-tagged | +Inquiry |
Pyy-1457R | Recombinant Rat Pyy protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
0
Inquiry Basket