Recombinant Full Length Human PYY Protein, GST tagged
| Cat.No. : | PYY-29935TH |
| Product Overview : | Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 1-97 a.a. |
| Description : | The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
| Sequence Similarities : | Belongs to the NPY family. |
| Gene Name | PYY peptide YY [ Homo sapiens ] |
| Official Symbol | PYY |
| Synonyms | PYY; peptide YY; PYY1; |
| Gene ID | 5697 |
| mRNA Refseq | NM_004160 |
| Protein Refseq | NP_004151 |
| Uniprot ID | P10082 |
| Chromosome Location | 17q21.1 |
| Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; |
| Function | hormone activity; neuropeptide hormone activity; |
| ◆ Recombinant Proteins | ||
| PYY-370H | Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PYY-3397H | Recombinant Human PYY protein, GST-tagged | +Inquiry |
| PYY-29935TH | Recombinant Full Length Human PYY Protein, GST tagged | +Inquiry |
| PYY-2088H | Recombinant Human PYY, His-tagged | +Inquiry |
| PYY-2831H | Recombinant Human PYY Protein, His-tagged, OVA Conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
