Recombinant Full Length Human QDPR Protein, His-tagged
Cat.No. : | QDPR-679H |
Product Overview : | Recombinant Human QDPR fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl, pH8.0 |
Molecular Mass : | 26.8kD |
AA Sequence : | MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYFVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | QDPR quinoid dihydropteridine reductase [ Homo sapiens ] |
Official Symbol | QDPR |
Synonyms | QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; HDHPR; 6,7-dihydropteridine reductase; short chain dehydrogenase/reductase family 33C, member 1; FLJ42391; |
Gene ID | 5860 |
mRNA Refseq | NM_000320 |
Protein Refseq | NP_000311 |
MIM | 612676 |
UniProt ID | P09417 |
◆ Recombinant Proteins | ||
QDPR-160H | Recombinant Full Length Human QDPR Protein, MYC/DDK-tagged | +Inquiry |
QDPR-3732H | Recombinant Full Length Human QDPR Protein, GST-tagged | +Inquiry |
QDPR-2090H | Recombinant Full Length Human QDPR Protein, His-tagged | +Inquiry |
QDPR-13760M | Recombinant Mouse QDPR Protein | +Inquiry |
QDPR-4863R | Recombinant Rat QDPR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
QDPR-520HCL | Recombinant Human QDPR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QDPR Products
Required fields are marked with *
My Review for All QDPR Products
Required fields are marked with *
0
Inquiry Basket