Recombinant Full Length Human RAB33A Protein, C-Flag-tagged

Cat.No. : RAB33A-1981HFL
Product Overview : Recombinant Full Length Human RAB33A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 26.4 kDa
AA Sequence : MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY RDAERQQGKVQKLEFPQEANSKTSCPC myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name RAB33A RAB33A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB33A
Synonyms RabS10
Gene ID 9363
mRNA Refseq NM_004794.3
Protein Refseq NP_004785.1
MIM 300333
UniProt ID Q14088

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB33A Products

Required fields are marked with *

My Review for All RAB33A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon