Recombinant Full Length Human RAB33A Protein, C-Flag-tagged
Cat.No. : | RAB33A-1981HFL |
Product Overview : | Recombinant Full Length Human RAB33A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY RDAERQQGKVQKLEFPQEANSKTSCPC myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB33A RAB33A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB33A |
Synonyms | RabS10 |
Gene ID | 9363 |
mRNA Refseq | NM_004794.3 |
Protein Refseq | NP_004785.1 |
MIM | 300333 |
UniProt ID | Q14088 |
◆ Recombinant Proteins | ||
RAB33A-4379Z | Recombinant Zebrafish RAB33A | +Inquiry |
RAB33A-3514H | Recombinant Human RAB33A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB33A-1831H | Recombinant Human RAB33A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB33A-3746R | Recombinant Rhesus monkey RAB33A Protein, His-tagged | +Inquiry |
RAB33A-7350M | Recombinant Mouse RAB33A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB33A-2606HCL | Recombinant Human RAB33A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB33A Products
Required fields are marked with *
My Review for All RAB33A Products
Required fields are marked with *