Recombinant Full Length Human RAB35 Protein, C-Flag-tagged
| Cat.No. : | RAB35-1648HFL |
| Product Overview : | Recombinant Full Length Human RAB35 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables GTPase activity; guanyl ribonucleotide binding activity; and phosphatidylinositol-4,5-bisphosphate binding activity. Involved in several processes, including endosomal transport; plasma membrane to endosome transport; and protein localization to endosome. Located in several cellular components, including clathrin-coated endocytic vesicle; clathrin-coated pit; and intercellular bridge. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 22.8 kDa |
| AA Sequence : | MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERF RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAG QMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | RAB35 RAB35, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB35 |
| Synonyms | RAY; H-ray; RAB1C |
| Gene ID | 11021 |
| mRNA Refseq | NM_006861.7 |
| Protein Refseq | NP_006852.1 |
| MIM | 604199 |
| UniProt ID | Q15286 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB35 Products
Required fields are marked with *
My Review for All RAB35 Products
Required fields are marked with *




