Recombinant Full Length Human RAB35 Protein, His-tagged
| Cat.No. : | RAB35-29052TH |
| Product Overview : | Recombinant full length Human RAB35 with an N terminal His tag; 221 amino acids with tag, Predicted MWt 25.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 a.a. |
| Conjugation : | HIS |
| Molecular Weight : | 25.200kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
| Gene Name | RAB35 RAB35, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB35 |
| Synonyms | RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray; |
| Gene ID | 11021 |
| mRNA Refseq | NM_001167606 |
| Protein Refseq | NP_001161078 |
| MIM | 604199 |
| Uniprot ID | Q15286 |
| Chromosome Location | 12q24 |
| Function | GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol-4,5-bisphosphate binding; |
| ◆ Recombinant Proteins | ||
| RAB35-4547R | Recombinant Rat RAB35 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB35-2116H | Recombinant Full Length Human RAB35 Protein, GST-tagged | +Inquiry |
| RAB35-6869H | Recombinant Human RAB35, Member RAS Oncogene Family, His-tagged | +Inquiry |
| Rab35-5311M | Recombinant Mouse Rab35 Protein, Myc/DDK-tagged | +Inquiry |
| RAB35-29052TH | Recombinant Full Length Human RAB35 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB35-2604HCL | Recombinant Human RAB35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB35 Products
Required fields are marked with *
My Review for All RAB35 Products
Required fields are marked with *



