Recombinant Full Length Human RAB38 Protein, C-Flag-tagged
Cat.No. : | RAB38-2076HFL |
Product Overview : | Recombinant Full Length Human RAB38 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including AP-1 adaptor complex binding activity; AP-3 adaptor complex binding activity; and BLOC-2 complex binding activity. Involved in several processes, including endosome to melanosome transport; melanosome assembly; and phagosome acidification. Located in several cellular components, including cytoplasmic vesicle; lysosome; and mitochondria-associated endoplasmic reticulum membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.5 kDa |
AA Sequence : | MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK S myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB38 RAB38, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB38 |
Synonyms | rrGTPbp; NY-MEL-1 |
Gene ID | 23682 |
mRNA Refseq | NM_022337.3 |
Protein Refseq | NP_071732.1 |
MIM | 606281 |
UniProt ID | P57729 |
◆ Recombinant Proteins | ||
RAB38-2076HFL | Recombinant Full Length Human RAB38 Protein, C-Flag-tagged | +Inquiry |
RAB38-1089H | Recombinant Human RAB38 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB38-2117H | Recombinant Human RAB38, GST-tagged | +Inquiry |
RAB38-1834H | Recombinant Human RAB38 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab38-5314M | Recombinant Mouse Rab38 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB38-2600HCL | Recombinant Human RAB38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB38 Products
Required fields are marked with *
My Review for All RAB38 Products
Required fields are marked with *
0
Inquiry Basket