Recombinant Full Length Human RAB3A protein, GST-tagged
Cat.No. : | RAB3A-1880H |
Product Overview : | Recombinant Human RAB3A protein(1-220 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-220 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB3A RAB3A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB3A |
Synonyms | RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS associated protein RAB3A; RAS-associated protein RAB3A; |
Gene ID | 5864 |
mRNA Refseq | NM_002866 |
Protein Refseq | NP_002857 |
MIM | 179490 |
UniProt ID | P20336 |
◆ Recombinant Proteins | ||
RAB3A-580C | Recombinant Cynomolgus Monkey RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB3A-305H | Recombinant Human RAB3A Protein, MYC/DDK-tagged | +Inquiry |
Rab3a-1112R | Active Recombinant Rat RAB3A, Member RAS Oncogene Family, GST-tagged | +Inquiry |
Rab3a-5317M | Recombinant Mouse Rab3a Protein, Myc/DDK-tagged | +Inquiry |
RAB3A-3586H | Recombinant Full Length Human RAB3A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3A Products
Required fields are marked with *
My Review for All RAB3A Products
Required fields are marked with *