Recombinant Full Length Human RAB3A protein, GST-tagged
| Cat.No. : | RAB3A-1880H |
| Product Overview : | Recombinant Human RAB3A protein(1-220 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-220 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAB3A RAB3A, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB3A |
| Synonyms | RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS associated protein RAB3A; RAS-associated protein RAB3A; |
| Gene ID | 5864 |
| mRNA Refseq | NM_002866 |
| Protein Refseq | NP_002857 |
| MIM | 179490 |
| UniProt ID | P20336 |
| ◆ Recombinant Proteins | ||
| RAB3A-4889R | Recombinant Rat RAB3A Protein | +Inquiry |
| RAB3A-3751R | Recombinant Rhesus monkey RAB3A Protein, His-tagged | +Inquiry |
| RAB3A-1880H | Recombinant Full Length Human RAB3A protein, GST-tagged | +Inquiry |
| RAB3A-305H | Recombinant Human RAB3A Protein, MYC/DDK-tagged | +Inquiry |
| RAB3A-708M | Active Recombinant Full Length Mouse RAB3A Protein, GST/His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3A Products
Required fields are marked with *
My Review for All RAB3A Products
Required fields are marked with *
