Recombinant Full Length Human RAB3A protein, GST-tagged

Cat.No. : RAB3A-1880H
Product Overview : Recombinant Human RAB3A protein(1-220 aa), fused to GST tag, was expressed in E. coli.
Availability December 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-220 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RAB3A RAB3A, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB3A
Synonyms RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS associated protein RAB3A; RAS-associated protein RAB3A;
Gene ID 5864
mRNA Refseq NM_002866
Protein Refseq NP_002857
MIM 179490
UniProt ID P20336

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB3A Products

Required fields are marked with *

My Review for All RAB3A Products

Required fields are marked with *

0
cart-icon
0
compare icon