Recombinant Full Length Human RAB8B Protein, C-Flag-tagged
Cat.No. : | RAB8B-1078HFL |
Product Overview : | Recombinant Full Length Human RAB8B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB8B RAB8B, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB8B |
Synonyms | FLJ38125 |
Gene ID | 51762 |
mRNA Refseq | NM_016530.3 |
Protein Refseq | NP_057614.1 |
MIM | 613532 |
UniProt ID | Q92930 |
◆ Recombinant Proteins | ||
RAB8B-3761R | Recombinant Rhesus monkey RAB8B Protein, His-tagged | +Inquiry |
RAB8B-5754Z | Recombinant Zebrafish RAB8B | +Inquiry |
RAB8B-1842H | Recombinant Human RAB8B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB8B-13840M | Recombinant Mouse RAB8B Protein | +Inquiry |
RAB8B-1078HFL | Recombinant Full Length Human RAB8B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB8B-2579HCL | Recombinant Human RAB8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB8B Products
Required fields are marked with *
My Review for All RAB8B Products
Required fields are marked with *
0
Inquiry Basket