Recombinant Full Length Human RAC3 Protein, C-Flag-tagged
Cat.No. : | RAC3-1207HFL |
Product Overview : | Recombinant Full Length Human RAC3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-192 a.a. |
Description : | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.2 kDa |
AA Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adherens junction, Axon guidance, B cell receptor signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | RAC3 Rac family small GTPase 3 [ Homo sapiens (human) ] |
Official Symbol | RAC3 |
Synonyms | ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); rho family, small GTP binding protein Rac3 |
Gene ID | 5881 |
mRNA Refseq | NM_005052.3 |
Protein Refseq | NP_005043.1 |
MIM | 602050 |
UniProt ID | P60763 |
◆ Recombinant Proteins | ||
RAC3-3391H | Recombinant Human RAC3 | +Inquiry |
RAC3-1207HFL | Recombinant Full Length Human RAC3 Protein, C-Flag-tagged | +Inquiry |
RAC3-13859M | Recombinant Mouse RAC3 Protein | +Inquiry |
RAC3-6573C | Recombinant Chicken RAC3 | +Inquiry |
Rac3-5345M | Recombinant Mouse Rac3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAC3 Products
Required fields are marked with *
My Review for All RAC3 Products
Required fields are marked with *
0
Inquiry Basket