Recombinant Full Length Human RAD23B Protein, C-Flag-tagged
Cat.No. : | RAD23B-1655HFL |
Product Overview : | Recombinant Full Length Human RAD23B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43 kDa |
AA Sequence : | MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFV VVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPA SAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAA LRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGVPQSSAVAAAAATTTATTTTTSSGGHPLEFLR NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIA EAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | RAD23B RAD23 homolog B, nucleotide excision repair protein [ Homo sapiens (human) ] |
Official Symbol | RAD23B |
Synonyms | P58; HR23B; HHR23B |
Gene ID | 5887 |
mRNA Refseq | NM_002874.5 |
Protein Refseq | NP_002865.1 |
MIM | 600062 |
UniProt ID | P54727 |
◆ Recombinant Proteins | ||
RAD23B-4568R | Recombinant Rat RAD23B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAD23B-6134H | Recombinant Human RAD23B Protein (Gln2-Asp409), N-His tagged | +Inquiry |
RAD23B-4563H | Recombinant Human RAD23B protein, His-tagged | +Inquiry |
RAD23B-6133H | Recombinant Human RAD23B Protein (full-length), N-His tagged | +Inquiry |
RAD23B-1850H | Recombinant Human RAD23B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD23B-2558HCL | Recombinant Human RAD23B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD23B Products
Required fields are marked with *
My Review for All RAD23B Products
Required fields are marked with *
0
Inquiry Basket