Recombinant Human RAD23B

Cat.No. : RAD23B-29311TH
Product Overview : Recombinant fragment of Human hHR23b with N terminal proprietary tag, 36.52kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Sequence Similarities : Belongs to the RAD23 family.Contains 1 STI1 domain.Contains 2 UBA domains.Contains 1 ubiquitin-like domain.
Gene Name RAD23B RAD23 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD23B
Synonyms RAD23B; RAD23 homolog B (S. cerevisiae); RAD23 (S. cerevisiae) homolog B; UV excision repair protein RAD23 homolog B; HHR23B; HR23B; P58; XP C repair complementing complex 58 kDa; XP C repair complementing protein;
Gene ID 5887
mRNA Refseq NM_001244713
Protein Refseq NP_001231642
MIM 600062
Uniprot ID P54727
Chromosome Location 9q31.2
Pathway DNA Damage Recognition in GG-NER, organism-specific biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Formation of incision complex in GG-NER, organism-specific biosystem; Global Genomic NER (GG-NER), organism-specific biosystem;
Function damaged DNA binding; polyubiquitin binding; protein binding; single-stranded DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAD23B Products

Required fields are marked with *

My Review for All RAD23B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon