Recombinant Full Length Human RAD52 Protein, C-Flag-tagged
Cat.No. : | RAD52-1565HFL |
Product Overview : | Recombinant Full Length Human RAD52 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair. A pseudogene of this gene is present on chromosome 2. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46 kDa |
AA Sequence : | MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHR VINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLE KARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRP NMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVS TPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Homologous recombination |
Full Length : | Full L. |
Gene Name | RAD52 RAD52 homolog, DNA repair protein [ Homo sapiens (human) ] |
Official Symbol | RAD52 |
Synonyms | RP11-359B12.2 |
Gene ID | 5893 |
mRNA Refseq | NM_134424.4 |
Protein Refseq | NP_602296.2 |
MIM | 600392 |
UniProt ID | P43351 |
◆ Recombinant Proteins | ||
RAD52-4200B | Recombinant Baker's yeast RAD52 protein, His-SUMO-tagged | +Inquiry |
RAD52-2668H | Recombinant Full Length Human RAD52, GST-tagged | +Inquiry |
RAD52-4028C | Recombinant Chicken RAD52 | +Inquiry |
Rad52-5351M | Recombinant Mouse Rad52 Protein, Myc/DDK-tagged | +Inquiry |
RAD52-13875M | Recombinant Mouse RAD52 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD52 Products
Required fields are marked with *
My Review for All RAD52 Products
Required fields are marked with *
0
Inquiry Basket