| Species : |
Human |
| Source : |
In Vitro Cell Free System |
| Protein Length : |
527 amino acids |
| Description : |
This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. |
| Form : |
Liquid |
| Molecular Mass : |
84.04 kDa inclusive of tags |
| AA Sequence : |
MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |